Lineage for d7loza2 (7loz A:106-231)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583060Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries)
  8. 2583074Domain d7loza2: 7loz A:106-231 [402573]
    Other proteins in same PDB: d7loza3, d7lozb3, d7lozb4
    automated match to d1rg9a2
    complexed with edo, mg, po4, pop

Details for d7loza2

PDB Entry: 7loz (more details), 2.25 Å

PDB Description: s-adenosylmethionine synthetase
PDB Compounds: (A:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7loza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7loza2 d.130.1.0 (A:106-231) automated matches {Escherichia coli [TaxId: 1268998]}
vdradpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdak
sqvtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkffin
ptgrfv

SCOPe Domain Coordinates for d7loza2:

Click to download the PDB-style file with coordinates for d7loza2.
(The format of our PDB-style files is described here.)

Timeline for d7loza2: