Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Escherichia coli [TaxId:1268998] [402216] (5 PDB entries) |
Domain d7loza2: 7loz A:106-231 [402573] Other proteins in same PDB: d7loza3, d7lozb3, d7lozb4 automated match to d1rg9a2 complexed with edo, mg, po4, pop |
PDB Entry: 7loz (more details), 2.25 Å
SCOPe Domain Sequences for d7loza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7loza2 d.130.1.0 (A:106-231) automated matches {Escherichia coli [TaxId: 1268998]} vdradpleqgagdqglmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdak sqvtfqyddgkivgidavvlstqhseeidqkslqeavmeeiikpilpaewltsatkffin ptgrfv
Timeline for d7loza2:
View in 3D Domains from other chains: (mouse over for more information) d7lozb1, d7lozb2, d7lozb3, d7lozb4 |