Lineage for d7m1lg_ (7m1l G:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2462466Species Pseudomonas aeruginosa [TaxId:287] [275309] (3 PDB entries)
  8. 2462473Domain d7m1lg_: 7m1l G: [402487]
    automated match to d4jcra_
    complexed with po4

Details for d7m1lg_

PDB Entry: 7m1l (more details), 2 Å

PDB Description: crystal structure of pseudomonas aeruginosa clpp2
PDB Compounds: (G:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d7m1lg_:

Sequence, based on SEQRES records: (download)

>d7m1lg_ c.14.1.0 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hgaigaklmeyalkvrkvfvtggvdekmakdvvqqlhilasisddpiymfvnspgghves
gdmifdairfitpkvimigsgsvasagaliyaaadkenryslpntrfllhqpsggiqgpa
snieiyrreivrmkerldrifaeatgqtpekisadterdfwlnaeeavqyglvnkiivse
reitlp

Sequence, based on observed residues (ATOM records): (download)

>d7m1lg_ c.14.1.0 (G:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hgaigaklmeyalkvrkvfvtggvdekmakdvvqqlhilasisddpiymfvnspgghves
gdmifdairfitpkvimigsgsvasagaliyaaadkenryslpntrfllhqpsasnieiy
rreivrmkerldrifaeatgqtpekisadterdfwlnaeeavqyglvnkiivsereitlp

SCOPe Domain Coordinates for d7m1lg_:

Click to download the PDB-style file with coordinates for d7m1lg_.
(The format of our PDB-style files is described here.)

Timeline for d7m1lg_: