Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
Protein automated matches [402219] (1 species) not a true protein |
Species Escherichia coli [TaxId:1268998] [402220] (5 PDB entries) |
Domain d7lo2a3: 7lo2 A:232-383 [402429] Other proteins in same PDB: d7lo2a1, d7lo2a2, d7lo2b1, d7lo2b2, d7lo2c1, d7lo2c2, d7lo2d1, d7lo2d2 automated match to d1mxaa3 complexed with edo, k, mg, pg4, po4, pop |
PDB Entry: 7lo2 (more details), 1.89 Å
SCOPe Domain Sequences for d7lo2a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lo2a3 d.130.1.1 (A:232-383) automated matches {Escherichia coli [TaxId: 1268998]} iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy ketaayghfgrehfpwektdkaqllrdaaglk
Timeline for d7lo2a3: