Lineage for d1tbda1 (1tbd A:3-132)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528607Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2528608Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2528609Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 2528610Protein The origin DNA-binding domain of SV40 T-antigen [55466] (2 species)
  7. 2528617Species Simian virus 40, Sv40 [TaxId:10633] [55467] (10 PDB entries)
  8. 2528631Domain d1tbda1: 1tbd A:3-132 [40240]
    Other proteins in same PDB: d1tbda2, d1tbda3

Details for d1tbda1

PDB Entry: 1tbd (more details)

PDB Description: solution structure of the origin dna binding domain of sv40 t-antigen, nmr, minimized average structure
PDB Compounds: (A:) sv40 t-antigen

SCOPe Domain Sequences for d1tbda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbda1 d.89.1.1 (A:3-132) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
kvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhnsy
nhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieeslpg
glkehdfnpe

SCOPe Domain Coordinates for d1tbda1:

Click to download the PDB-style file with coordinates for d1tbda1.
(The format of our PDB-style files is described here.)

Timeline for d1tbda1: