![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.88: SRF-like [55454] (1 superfamily) |
![]() | Superfamily d.88.1: SRF-like [55455] (1 family) ![]() |
![]() | Family d.88.1.1: SRF-like [55456] (3 proteins) |
![]() | Protein Mef2a core [55461] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries) |
![]() | Domain d1c7ua_: 1c7u A: [40238] |
PDB Entry: 1c7u (more details)
SCOP Domain Sequences for d1c7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ua_ d.88.1.1 (A:) Mef2a core {Human (Homo sapiens)} grkkiqitrimdernrqvtftkrkfglmkkayelsvladaeialiifnssnklfqyastd mdkvllkyteynep
Timeline for d1c7ua_: