Lineage for d1egwa_ (1egw A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135595Fold d.88: SRF-like [55454] (1 superfamily)
  4. 135596Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 135597Family d.88.1.1: SRF-like [55456] (3 proteins)
  6. 135602Protein Mef2a core [55461] (1 species)
  7. 135603Species Human (Homo sapiens) [TaxId:9606] [55462] (2 PDB entries)
  8. 135604Domain d1egwa_: 1egw A: [40234]

Details for d1egwa_

PDB Entry: 1egw (more details), 1.5 Å

PDB Description: crystal structure of mef2a core bound to dna

SCOP Domain Sequences for d1egwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egwa_ d.88.1.1 (A:) Mef2a core {Human (Homo sapiens)}
grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd
mdkvllkytey

SCOP Domain Coordinates for d1egwa_:

Click to download the PDB-style file with coordinates for d1egwa_.
(The format of our PDB-style files is described here.)

Timeline for d1egwa_: