SCOPe 2.08: Domain d7lv7c1: 7lv7 C:1-355

Lineage for d7lv7c1 (7lv7 C:1-355)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.0: automated matches [191499] (1 protein)
   not a true family

6. Protein automated matches [190815] (21 species)
   not a true protein

7. Species Giardia intestinalis [TaxId:184922] [402326] (1 PDB entry)

8. Domain d7lv7c1: 7lv7 C:1-355 [402329]
   Other proteins in same PDB: d7lv7a2, d7lv7b2, d7lv7c2, d7lv7d2
   automated match to d4dqna_
   complexed with cl, edo, llp, mg

Details for d7lv7c1

PDB Entry: 7lv7, 2.1 Å

PDB Description: crystal structure of branched-chain amino acid aminotransferase from giardia lamblia atcc 50803

PDB Compounds: (C:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d7lv7c1:

Sequence; same for both SEQRES and ATOM records:

>d7lv7c1 e.17.1.0 (C:1-355) automated matches {Giardia intestinalis [TaxId: 184922]}
mavdpstidwsalkfswlqtrshvrsvwrngewsplelvneptfnisiaasalhygqavf
eglkvfrtvdgrvaafrpvenarrlisscdglcmespseqlflnalamvvrdnvdyippy
gtggslyvrplvigtgaqlgvapsseymflmmvapvgpyyrgglksvnaivmdefdraap
ygvgskkcagnyaaslkaqsvalkksfpiqlyldaathtfveefstsnffgikdiqrdga
gkivsctyvtpkspsilpsitnktlrelisqyfgwkvdvrevpftevktfqecgatgtav
vvtpiasitrgstvidflqsddqvgevtkllyetvqgiqygvipdrfnwnhyidv

Timeline for d7lv7c1:

• d7lv7c1 first appeared in SCOPe 2.07