Lineage for d7lowb3 (7low B:232-382)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582827Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins)
  6. 2582946Protein automated matches [402219] (1 species)
    not a true protein
  7. 2582947Species Escherichia coli [TaxId:1268998] [402220] (5 PDB entries)
  8. 2582957Domain d7lowb3: 7low B:232-382 [402310]
    Other proteins in same PDB: d7lowa1, d7lowa2, d7lowb1, d7lowb2, d7lowb4
    automated match to d1mxaa3

Details for d7lowb3

PDB Entry: 7low (more details), 2.39 Å

PDB Description: s-adenosylmethionine synthetase
PDB Compounds: (B:) S-adenosylmethionine synthase

SCOPe Domain Sequences for d7lowb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7lowb3 d.130.1.1 (B:232-382) automated matches {Escherichia coli [TaxId: 1268998]}
iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla
drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy
ketaayghfgrehfpwektdkaqllrdaagl

SCOPe Domain Coordinates for d7lowb3:

Click to download the PDB-style file with coordinates for d7lowb3.
(The format of our PDB-style files is described here.)

Timeline for d7lowb3: