Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.1: S-adenosylmethionine synthetase [55974] (2 proteins) |
Protein automated matches [402219] (1 species) not a true protein |
Species Escherichia coli [TaxId:1268998] [402220] (5 PDB entries) |
Domain d7lowb3: 7low B:232-382 [402310] Other proteins in same PDB: d7lowa1, d7lowa2, d7lowb1, d7lowb2, d7lowb4 automated match to d1mxaa3 |
PDB Entry: 7low (more details), 2.39 Å
SCOPe Domain Sequences for d7lowb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7lowb3 d.130.1.1 (B:232-382) automated matches {Escherichia coli [TaxId: 1268998]} iggpmgdcgltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagla drceiqvsyaigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiy ketaayghfgrehfpwektdkaqllrdaagl
Timeline for d7lowb3: