Lineage for d1srsa_ (1srs A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204555Fold d.88: SRF-like [55454] (1 superfamily)
    alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet
  4. 2204556Superfamily d.88.1: SRF-like [55455] (1 family) (S)
  5. 2204557Family d.88.1.1: SRF-like [55456] (5 proteins)
  6. 2204578Protein Serum response factor (SRF) core [55457] (1 species)
  7. 2204579Species Human (Homo sapiens) [TaxId:9606] [55458] (3 PDB entries)
  8. 2204580Domain d1srsa_: 1srs A: [40230]
    protein/DNA complex

Details for d1srsa_

PDB Entry: 1srs (more details), 3.2 Å

PDB Description: serum response factor (srf) core complexed with specific sre dna
PDB Compounds: (A:) protein (serum response factor (srf))

SCOPe Domain Sequences for d1srsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1srsa_ d.88.1.1 (A:) Serum response factor (SRF) core {Human (Homo sapiens) [TaxId: 9606]}
trgrvkikmefidnklrryttfskrktgimkkayelstltgtqvlllvasetghvytfat
rklqpmitsetgkaliqtclnspd

SCOPe Domain Coordinates for d1srsa_:

Click to download the PDB-style file with coordinates for d1srsa_.
(The format of our PDB-style files is described here.)

Timeline for d1srsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1srsb_