SCOPe 2.08: Domain d7deoa2: 7deo A:128-247

Lineage for d7deoa2 (7deo A:128-247)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d7deoa2: 7deo A:128-247 [402049]
   Other proteins in same PDB: d7deob1, d7deob2, d7deod_
   automated match to d2ybrh_
   complexed with ca, nag

Details for d7deoa2

PDB Entry: 7deo, 2.5 Å

PDB Description: crystal structure of sars-cov-2 rbd in complex with a neutralizing antibody scfv

PDB Compounds: (A:) antibody scFv

SCOPe Domain Sequences for d7deoa2:

Sequence; same for both SEQRES and ATOM records:

>d7deoa2 b.1.1.0 (A:128-247) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggsggggsdivmtqsplslpvtpgepasiscrssqsllhsngynyldwylqkpgqspqll
iylgsnrasgvpdrfsgsgsgtdftlkisrveaedvgvyycmqglqtpltfgggtkveik

Timeline for d7deoa2:

• d7deoa2 first appeared in SCOPe 2.07