Lineage for d1npx_3 (1npx 322-447)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) 
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (8 proteins) 
Protein NADH peroxidase [55432] (1 species) Species Enterococcus faecalis [TaxId:1351] [55433] (8 PDB entries) 
Domain d1npx_3: 1npx 322-447 [40200]
Other proteins in same PDB: d1npx_1, d1npx_2
Details for d1npx_3
PDB Entry: 1npx (more details), 2.16 Å
PDB Description: structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
SCOP Domain Sequences for d1npx_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1npx_3 d.87.1.1 (322-447) NADH peroxidase {Enterococcus faecalis}
gvqgssglavfdykfastginevmaqklgketkavtvvedylmdfnpdkqkawfklvydp
ettqilgaqlmskadltaninaislaiqakmtiedlayadfffqpafdkpwniintaale
avkqer
SCOP Domain Coordinates for d1npx_3:
Click to download the PDB-style file with coordinates for d1npx_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1npx_3:
- d1npx_3 first appeared (with stable ids) in SCOP 1.55
- d1npx_3 appears in SCOP 1.57
- d1npx_3 appears in SCOP 1.61
- d1npx_3 appears in the current release, SCOPe 2.08, called d1npxa3
View in 3D
