Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) both first two domains are of same beta/beta/alpha fold |
Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins) |
Protein Trypanothione reductase [55429] (3 species) |
Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries) |
Domain d1typb3: 1typ B:359-487 [40187] Other proteins in same PDB: d1typa1, d1typa2, d1typb1, d1typb2 complexed with fad, gsh, nap |
PDB Entry: 1typ (more details), 2.8 Å
SCOPe Domain Sequences for d1typb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1typb3 d.87.1.1 (B:359-487) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy qkgkrveki
Timeline for d1typb3: