Lineage for d1feac3 (1fea C:358-487)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2569462Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2569463Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2569464Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2569595Protein Trypanothione reductase [55429] (3 species)
  7. 2569596Species Crithidia fasciculata [TaxId:5656] [55430] (6 PDB entries)
  8. 2569603Domain d1feac3: 1fea C:358-487 [40182]
    Other proteins in same PDB: d1feaa1, d1feaa2, d1feab1, d1feab2, d1feac1, d1feac2, d1fead1, d1fead2
    complexed with fad

Details for d1feac3

PDB Entry: 1fea (more details), 2.2 Å

PDB Description: unliganded crithidia fasciculata trypanothione reductase at 2.2 angstrom resolution
PDB Compounds: (C:) trypanothione reductase

SCOPe Domain Sequences for d1feac3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1feac3 d.87.1.1 (C:358-487) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]}
htkvacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtn
hadgevlgvhmlgdsspeiiqsvaiclkmgakisdfyntigvhptsaeelcsmrtpayfy
ekgkrvekid

SCOPe Domain Coordinates for d1feac3:

Click to download the PDB-style file with coordinates for d1feac3.
(The format of our PDB-style files is described here.)

Timeline for d1feac3: