Lineage for d6zt3a2 (6zt3 A:246-425)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2538081Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2538082Protein automated matches [190826] (22 species)
    not a true protein
  7. 2538267Species Mycolicibacterium smegmatis [TaxId:246196] [401564] (2 PDB entries)
  8. 2538268Domain d6zt3a2: 6zt3 A:246-425 [401616]
    Other proteins in same PDB: d6zt3a1, d6zt3a3
    automated match to d1s16a1
    protein/DNA complex; complexed with anp, edo, k, mg, na

Details for d6zt3a2

PDB Entry: 6zt3 (more details), 1.56 Å

PDB Description: n-terminal 47 kda fragment of the mycobacterium smegmatis dna gyrase b subunit complexed with adpnp
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d6zt3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zt3a2 d.14.1.0 (A:246-425) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
vkhrvfhypgglvdyvkhinrtktpiqqsiidfdgkgpgheveiamqwnagysesvhtfa
ntintheggtheegfraaltsvvnryakdkkllkdkdpnltgddireglaavisvkvaep
qfegqtktklgntevksfvqkicneqlqhwfeanpaeaktvvnkavssaqariaarkare

SCOPe Domain Coordinates for d6zt3a2:

Click to download the PDB-style file with coordinates for d6zt3a2.
(The format of our PDB-style files is described here.)

Timeline for d6zt3a2: