Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.0: automated matches [191504] (1 protein) not a true family |
Protein automated matches [190826] (22 species) not a true protein |
Species Mycolicibacterium smegmatis [TaxId:246196] [401564] (2 PDB entries) |
Domain d6zt3a2: 6zt3 A:246-425 [401616] Other proteins in same PDB: d6zt3a1, d6zt3a3 automated match to d1s16a1 protein/DNA complex; complexed with anp, edo, k, mg, na |
PDB Entry: 6zt3 (more details), 1.56 Å
SCOPe Domain Sequences for d6zt3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zt3a2 d.14.1.0 (A:246-425) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]} vkhrvfhypgglvdyvkhinrtktpiqqsiidfdgkgpgheveiamqwnagysesvhtfa ntintheggtheegfraaltsvvnryakdkkllkdkdpnltgddireglaavisvkvaep qfegqtktklgntevksfvqkicneqlqhwfeanpaeaktvvnkavssaqariaarkare
Timeline for d6zt3a2: