![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) |
![]() | Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) ![]() |
![]() | Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (9 proteins) |
![]() | Protein Glutathione reductase [55426] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [55427] (17 PDB entries) |
![]() | Domain d1grg_3: 1grg 364-478 [40159] Other proteins in same PDB: d1grg_1, d1grg_2 |
PDB Entry: 1grg (more details), 2 Å
SCOP Domain Sequences for d1grg_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1grg_3 d.87.1.1 (364-478) Glutathione reductase {Human (Homo sapiens)} ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Timeline for d1grg_3: