Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily) membrane all-alpha fold |
Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) |
Family f.3.1.0: automated matches [254203] (1 protein) not a true family |
Protein automated matches [254444] (7 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:258594] [401398] (2 PDB entries) |
Domain d6z5su_: 6z5s U: [401427] Other proteins in same PDB: d6z5sh1, d6z5sh2, d6z5sl_, d6z5sm_ automated match to d1wrga_ complexed with 6pl, bcl, bph, cdl, crt, fe, fme, lmt, pgt, qak, u10 |
PDB Entry: 6z5s (more details), 2.65 Å
SCOPe Domain Sequences for d6z5su_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z5su_ f.3.1.0 (U:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]} isglseaeakefhsifvtsfflfivvavvahilawmwrpwlpkatgy
Timeline for d6z5su_:
View in 3D Domains from other chains: (mouse over for more information) d6z5s1_, d6z5s2_, d6z5s3_, d6z5s4_, d6z5s5_, d6z5s6_, d6z5sa_, d6z5sb_, d6z5sc_, d6z5sd_, d6z5se_, d6z5sf_, d6z5sg_, d6z5sh1, d6z5sh2, d6z5si_, d6z5sj_, d6z5sk_, d6z5sl_, d6z5sm_, d6z5sn_, d6z5so_, d6z5sp_, d6z5sq_, d6z5sr_, d6z5ss_, d6z5st_, d6z5sv_, d6z5sx_, d6z5sy_, d6z5sz_ |