Lineage for d1dwnb_ (1dwn B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607033Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 607034Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 607035Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 607162Protein PP7 coat protein [55415] (1 species)
  7. 607163Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry)
  8. 607165Domain d1dwnb_: 1dwn B: [40142]

Details for d1dwnb_

PDB Entry: 1dwn (more details), 3.5 Å

PDB Description: Strucure of bacteriophage PP7 from Pseudomonas aeruginosa at 3.7 A resolution

SCOP Domain Sequences for d1dwnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dwnb_ d.85.1.1 (B:) PP7 coat protein {Bacteriophage PP7}
sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld
qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv
nlvplgr

SCOP Domain Coordinates for d1dwnb_:

Click to download the PDB-style file with coordinates for d1dwnb_.
(The format of our PDB-style files is described here.)

Timeline for d1dwnb_: