![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
![]() | Protein PP7 coat protein [55415] (1 species) |
![]() | Species Bacteriophage PP7 [TaxId:12023] [55416] (1 PDB entry) |
![]() | Domain d1dwnb_: 1dwn B: [40142] |
PDB Entry: 1dwn (more details), 3.5 Å
SCOPe Domain Sequences for d1dwnb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dwnb_ d.85.1.1 (B:) PP7 coat protein {Bacteriophage PP7 [TaxId: 12023]} sktivlsvgeatrtlteiqstadrqifeekvgplvgrlrltaslrqngaktayrvnlkld qadvvdcstsvcgelpkvrytqvwshdvtivansteasrkslydltkslvatsqvedlvv nlvplgr
Timeline for d1dwnb_: