Lineage for d1qbeb_ (1qbe B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033773Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1033774Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1033775Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1033909Protein Qbeta coat protein [55413] (1 species)
  7. 1033910Species Bacteriophage Qbeta [TaxId:39803] [55414] (1 PDB entry)
  8. 1033912Domain d1qbeb_: 1qbe B: [40139]

Details for d1qbeb_

PDB Entry: 1qbe (more details), 3.5 Å

PDB Description: bacteriophage q beta capsid
PDB Compounds: (B:) bacteriophage q beta capsid

SCOPe Domain Sequences for d1qbeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbeb_ d.85.1.1 (B:) Qbeta coat protein {Bacteriophage Qbeta [TaxId: 39803]}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
lidaidqlnpay

SCOPe Domain Coordinates for d1qbeb_:

Click to download the PDB-style file with coordinates for d1qbeb_.
(The format of our PDB-style files is described here.)

Timeline for d1qbeb_: