| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
| Protein Qbeta coat protein [55413] (1 species) |
| Species Bacteriophage Qbeta [TaxId:39803] [55414] (1 PDB entry) |
| Domain d1qbeb_: 1qbe B: [40139] |
PDB Entry: 1qbe (more details), 3.5 Å
SCOPe Domain Sequences for d1qbeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbeb_ d.85.1.1 (B:) Qbeta coat protein {Bacteriophage Qbeta [TaxId: 39803]}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
lidaidqlnpay
Timeline for d1qbeb_: