Lineage for d1qbeb_ (1qbe B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194166Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 194167Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 194168Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 194297Protein Qbeta coat protein [55413] (1 species)
  7. 194298Species Bacteriophage Qbeta [TaxId:39803] [55414] (1 PDB entry)
  8. 194300Domain d1qbeb_: 1qbe B: [40139]

Details for d1qbeb_

PDB Entry: 1qbe (more details), 3.5 Å

PDB Description: bacteriophage q beta capsid

SCOP Domain Sequences for d1qbeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbeb_ d.85.1.1 (B:) Qbeta coat protein {Bacteriophage Qbeta}
akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
lidaidqlnpay

SCOP Domain Coordinates for d1qbeb_:

Click to download the PDB-style file with coordinates for d1qbeb_.
(The format of our PDB-style files is described here.)

Timeline for d1qbeb_: