SCOP 1.59: Domain d1fr5c_: 1fr5 C:

Lineage for d1fr5c_ (1fr5 C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein fr coat protein [55411] (1 species)

7. Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)

8. Domain d1fr5c_: 1fr5 C: [40137]

Details for d1fr5c_

PDB Entry: 1fr5, 3.5 Å

PDB Description: phage fr capsids with a four residue deletion in the coat protein fg loop

SCOP Domain Sequences for d1fr5c_:

Sequence; same for both SEQRES and ATOM records:

>d1fr5c_ d.85.1.1 (C:) fr coat protein {Bacteriophage FR}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatgvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiataiaa
nsgiy

Timeline for d1fr5c_:

• d1fr5c_ first appeared (with stable ids) in SCOP 1.55
  
• d1fr5c_ appears in SCOP 1.57
  
• d1fr5c_ appears in SCOP 1.61
  
• d1fr5c_ appears in the current release, SCOPe 2.08