SCOPe 2.06: Domain d1frsc_: 1frs C:

Lineage for d1frsc_ (1frs C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein fr coat protein [55411] (1 species)

7. Species Bacteriophage FR [TaxId:12017] [55412] (2 PDB entries)

8. Domain d1frsc_: 1frs C: [40134]

Details for d1frsc_

PDB Entry: 1frs, 3.5 Å

PDB Description: crystal structure of bacteriophage fr capsids at 3.5 angstroms resolution

PDB Compounds: (C:) bacteriophage fr capsid

SCOPe Domain Sequences for d1frsc_:

Sequence; same for both SEQRES and ATOM records:

>d1frsc_ d.85.1.1 (C:) fr coat protein {Bacteriophage FR [TaxId: 12017]}
asnfeefvlvdnggtgdvkvapsnfangvaewissnsrsqaykvtcsvrqssannrkytv
kvevpkvatqvqggvelpvaawrsymnmeltipvfatnddcalivkalqgtfktgnpiat
aiaansgiy

Timeline for d1frsc_:

• d1frsc_ first appeared (with stable ids) in SCOP 1.55
  
• d1frsc_ appears in SCOPe 2.05
  
• d1frsc_ appears in SCOPe 2.07
  
• d1frsc_ appears in the current release, SCOPe 2.08