Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
Domain d6yd2a2: 6yd2 A:443-574 [401328] Other proteins in same PDB: d6yd2a1, d6yd2a3 automated match to d1p8ja1 complexed with 00s, bvk, ca, cl, dms, lys, na, on8, po4, tbg |
PDB Entry: 6yd2 (more details), 1.8 Å
SCOPe Domain Sequences for d6yd2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6yd2a2 b.18.1.0 (A:443-574) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvapqrkciidiltepkdigkrlevrktvtaclgepnhitrlehaqarltlsynrrgdla ihlvspmgtrstllaarphdysadgfndwafmtthswdedpsgewvleientseannygt ltkftlvlygta
Timeline for d6yd2a2: