Lineage for d1gavs_ (1gav S:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033773Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1033774Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1033775Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1033784Protein GA coat protein [55409] (1 species)
  7. 1033785Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 1033816Domain d1gavs_: 1gav S: [40114]
    contains 9 more identical chains denoted "a b c d e f g h i"

Details for d1gavs_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid
PDB Compounds: (S:) bacteriophage ga protein capsid

SCOPe Domain Sequences for d1gavs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gavs_ d.85.1.1 (S:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOPe Domain Coordinates for d1gavs_:

Click to download the PDB-style file with coordinates for d1gavs_.
(The format of our PDB-style files is described here.)

Timeline for d1gavs_: