Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [394299] (7 PDB entries) |
Domain d6xqla_: 6xql A: [401132] automated match to d5ocqa_ complexed with bgc, ca; mutant |
PDB Entry: 6xql (more details), 1.97 Å
SCOPe Domain Sequences for d6xqla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xqla_ b.29.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} vtapgnepmaipsdyklvwadefntpgapdakkwrydtsrnkegwynnelqyyaagrpen vrvengnlvietrkerltsmadyggqeyssgklftqgladwqygyvevraklacgkgmwp aiwmmasdgstgwpalgsidimemvawdpttihgtihtkaynhvihtqkgsrttaadpcg qfhtysldwtkdrmligvdghaymrfdndhkgnhdtwpfdspqylilnvaiggwggqqgv daaafpskmevdyvrvyqk
Timeline for d6xqla_: