Lineage for d6xqla_ (6xql A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391058Species Uncultured bacterium [TaxId:77133] [394299] (7 PDB entries)
  8. 2391064Domain d6xqla_: 6xql A: [401132]
    automated match to d5ocqa_
    complexed with bgc, ca; mutant

Details for d6xqla_

PDB Entry: 6xql (more details), 1.97 Å

PDB Description: crystal structure of sclam e144s mutant, a non-specific endo-beta-1, 3(4)-glucanase from family gh16, co-crystallized with cellohexaose, presenting a 1,3-beta-d-cellobiosyl-glucose at active site
PDB Compounds: (A:) GH16 family protein

SCOPe Domain Sequences for d6xqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xqla_ b.29.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}
vtapgnepmaipsdyklvwadefntpgapdakkwrydtsrnkegwynnelqyyaagrpen
vrvengnlvietrkerltsmadyggqeyssgklftqgladwqygyvevraklacgkgmwp
aiwmmasdgstgwpalgsidimemvawdpttihgtihtkaynhvihtqkgsrttaadpcg
qfhtysldwtkdrmligvdghaymrfdndhkgnhdtwpfdspqylilnvaiggwggqqgv
daaafpskmevdyvrvyqk

SCOPe Domain Coordinates for d6xqla_:

Click to download the PDB-style file with coordinates for d6xqla_.
(The format of our PDB-style files is described here.)

Timeline for d6xqla_: