Lineage for d1gavp_ (1gav P:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728536Protein GA coat protein [55409] (1 species)
  7. 728537Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 728565Domain d1gavp_: 1gav P: [40111]

Details for d1gavp_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid
PDB Compounds: (P:) bacteriophage ga protein capsid

SCOP Domain Sequences for d1gavp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gavp_ d.85.1.1 (P:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gavp_:

Click to download the PDB-style file with coordinates for d1gavp_.
(The format of our PDB-style files is described here.)

Timeline for d1gavp_: