Lineage for d1gav0_ (1gav 0:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728525Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 728526Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 728527Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 728536Protein GA coat protein [55409] (1 species)
  7. 728537Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 728540Domain d1gav0_: 1gav 0: [40131]
    contains 9 more identical chains denoted "a b c d e f g h i"

Details for d1gav0_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid
PDB Compounds: (0:) bacteriophage ga protein capsid

SCOP Domain Sequences for d1gav0_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gav0_ d.85.1.1 (0:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gav0_:

Click to download the PDB-style file with coordinates for d1gav0_.
(The format of our PDB-style files is described here.)

Timeline for d1gav0_: