Lineage for d1gavg_ (1gav G:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194166Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 194167Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 194168Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 194177Protein GA coat protein [55409] (1 species)
  7. 194178Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 194197Domain d1gavg_: 1gav G: [40102]

Details for d1gavg_

PDB Entry: 1gav (more details), 3.4 Å

PDB Description: bacteriophage ga protein capsid

SCOP Domain Sequences for d1gavg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gavg_ d.85.1.1 (G:) GA coat protein {Bacteriophage GA}
atlrsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtviskslaglfkvgnpiaea
issqsgfya

SCOP Domain Coordinates for d1gavg_:

Click to download the PDB-style file with coordinates for d1gavg_.
(The format of our PDB-style files is described here.)

Timeline for d1gavg_: