Lineage for d1unab_ (1una B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211268Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1211269Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1211270Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1211279Protein GA coat protein [55409] (1 species)
  7. 1211280Species Bacteriophage GA [TaxId:12018] [55410] (2 PDB entries)
  8. 1211282Domain d1unab_: 1una B: [40095]

Details for d1unab_

PDB Entry: 1una (more details), 2.8 Å

PDB Description: unassembled virus coat protein dimer, bacteriophage rna-binding dimer
PDB Compounds: (B:) ga unassembled coat protein dimer

SCOPe Domain Sequences for d1unab_:

Sequence, based on SEQRES records: (download)

>d1unab_ d.85.1.1 (B:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivtqvvngvelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaea
issqsgfya

Sequence, based on observed residues (ATOM records): (download)

>d1unab_ d.85.1.1 (B:) GA coat protein {Bacteriophage GA [TaxId: 12018]}
atlhsfvlvdnggtgnvtvvpvsnangvaewlsnnsrsqayrvtasyrasgadkrkytik
levpkivelpvsawkayasidltipifaatddvtvisksltglfkvgnpiaeaissqsgf
ya

SCOPe Domain Coordinates for d1unab_:

Click to download the PDB-style file with coordinates for d1unab_.
(The format of our PDB-style files is described here.)

Timeline for d1unab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1unaa_