Lineage for d1aq4c_ (1aq4 C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607033Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 607034Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 607035Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 607084Protein MS2 virus coat protein [55407] (1 species)
  7. 607085Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)
  8. 607155Domain d1aq4c_: 1aq4 C: [40093]
    protein/RNA complex; mutant

Details for d1aq4c_

PDB Entry: 1aq4 (more details), 3 Å

PDB Description: structure of a ms2 coat protein mutant in complex with an rna operator

SCOP Domain Sequences for d1aq4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq4c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1aq4c_:

Click to download the PDB-style file with coordinates for d1aq4c_.
(The format of our PDB-style files is described here.)

Timeline for d1aq4c_: