SCOP 1.71: Domain d1aq4a_: 1aq4 A:

Lineage for d1aq4a_ (1aq4 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (26 PDB entries)

8. Domain d1aq4a_: 1aq4 A: [40091]

Details for d1aq4a_

PDB Entry: 1aq4, 3 Å

PDB Description: structure of a ms2 coat protein mutant in complex with an rna operator

SCOP Domain Sequences for d1aq4a_:

Sequence; same for both SEQRES and ATOM records:

>d1aq4a_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d1aq4a_:

• d1aq4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1aq4a_ appears in SCOP 1.69
  
• d1aq4a_ appears in SCOP 1.73
  
• d1aq4a_ appears in the current release, SCOPe 2.08