Lineage for d1aq4b_ (1aq4 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194166Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 194167Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 194168Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 194217Protein MS2 virus coat protein [55407] (1 species)
  7. 194218Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 194281Domain d1aq4b_: 1aq4 B: [40092]

Details for d1aq4b_

PDB Entry: 1aq4 (more details), 3 Å

PDB Description: structure of a ms2 coat protein mutant in complex with an rna operator

SCOP Domain Sequences for d1aq4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aq4b_ d.85.1.1 (B:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d1aq4b_:

Click to download the PDB-style file with coordinates for d1aq4b_.
(The format of our PDB-style files is described here.)

Timeline for d1aq4b_: