Lineage for d6woda_ (6wod A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971538Protein Diphosphoinositol polyphosphate phosphohydrolase [143766] (1 species)
  7. 2971539Species Human (Homo sapiens) [TaxId:9606] [143767] (16 PDB entries)
    Uniprot O95989 8-142
  8. 2971543Domain d6woda_: 6wod A: [400916]
    automated match to d5ltub_
    complexed with cl, ihp, mg

Details for d6woda_

PDB Entry: 6wod (more details), 1.35 Å

PDB Description: diphosphoinositol polyphosphate phosphohydrolase 1 (dipp1/nudt3) in complex with inositol hexakisphosphate and mg, presoaked with 5-ip7, mg and fluoride, soaking 2min in the absence of fluoride.
PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 1

SCOPe Domain Sequences for d6woda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6woda_ d.113.1.1 (A:) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}
trtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevc
eeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikv
lqyhkpvqasyfet

SCOPe Domain Coordinates for d6woda_:

Click to download the PDB-style file with coordinates for d6woda_.
(The format of our PDB-style files is described here.)

Timeline for d6woda_: