![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
![]() | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
![]() | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
![]() | Protein MS2 virus coat protein [55407] (1 species) |
![]() | Species Bacteriophage MS2 [TaxId:12022] [55408] (28 PDB entries) Uniprot P03612 |
![]() | Domain d1aq4a_: 1aq4 A: [40091] protein/RNA complex; mutant |
PDB Entry: 1aq4 (more details), 3 Å
SCOPe Domain Sequences for d1aq4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aq4a_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d1aq4a_: