Lineage for d6woia_ (6woi A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971538Protein Diphosphoinositol polyphosphate phosphohydrolase [143766] (1 species)
  7. 2971539Species Human (Homo sapiens) [TaxId:9606] [143767] (16 PDB entries)
    Uniprot O95989 8-142
  8. 2971549Domain d6woia_: 6woi A: [400903]
    automated match to d5ltub_
    complexed with cl, f, mg, o81

Details for d6woia_

PDB Entry: 6woi (more details), 1.5 Å

PDB Description: diphosphoinositol polyphosphate phosphohydrolase 1 (dipp1/nudt3) in complex with 1-diphosphoinositol pentakisphosphate, mg, and fluoride ion, presoaked with 1,5-ip8, mg and fluoride for 30 seconds
PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 1

SCOPe Domain Sequences for d6woia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6woia_ d.113.1.1 (A:) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}
trtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrevc
eeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaikv
lqyhkpvqasyfet

SCOPe Domain Coordinates for d6woia_:

Click to download the PDB-style file with coordinates for d6woia_.
(The format of our PDB-style files is described here.)

Timeline for d6woia_: