SCOPe 2.06: Domain d1mvaa_: 1mva A:

Lineage for d1mvaa_ (1mva A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
   6-standed beta-sheet followed with 2 helices; meander

4. Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)

5. Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)

6. Protein MS2 virus coat protein [55407] (1 species)

7. Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries)
   Uniprot P03612

8. Domain d1mvaa_: 1mva A: [40088]
   mutant

Details for d1mvaa_

PDB Entry: 1mva, 3 Å

PDB Description: structure of a protein capsid of the t45a mutant of phage ms2

PDB Compounds: (A:) bacteriophage ms2 capsid

SCOPe Domain Sequences for d1mvaa_:

Sequence; same for both SEQRES and ATOM records:

>d1mvaa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

Timeline for d1mvaa_:

• d1mvaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1mvaa_ appears in SCOPe 2.05
  
• d1mvaa_ appears in SCOPe 2.07
  
• d1mvaa_ appears in the current release, SCOPe 2.08