Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) |
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
Protein MS2 virus coat protein [55407] (1 species) |
Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries) Uniprot P03612 |
Domain d1mvaa_: 1mva A: [40088] mutant |
PDB Entry: 1mva (more details), 3 Å
SCOPe Domain Sequences for d1mvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mvaa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]} asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvacsvrqssaqnrkyti kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips aiaansgiy
Timeline for d1mvaa_: