Lineage for d6msfa_ (6msf A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135313Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
  4. 135314Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 135315Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins)
  6. 135364Protein MS2 virus coat protein [55407] (1 species)
  7. 135365Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries)
  8. 135406Domain d6msfa_: 6msf A: [40067]

Details for d6msfa_

PDB Entry: 6msf (more details), 2.8 Å

PDB Description: f6 aptamer ms2 coat protein complex

SCOP Domain Sequences for d6msfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6msfa_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOP Domain Coordinates for d6msfa_:

Click to download the PDB-style file with coordinates for d6msfa_.
(The format of our PDB-style files is described here.)

Timeline for d6msfa_: