|  | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) | 
|  | Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander | 
|  | Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family)  | 
|  | Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) | 
|  | Protein MS2 virus coat protein [55407] (1 species) | 
|  | Species Bacteriophage MS2 [TaxId:12022] [55408] (36 PDB entries) Uniprot P03612 | 
|  | Domain d2ms2a_: 2ms2 A: [40049] | 
PDB Entry: 2ms2 (more details), 2.8 Å
SCOPe Domain Sequences for d2ms2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ms2a_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d2ms2a_: