Lineage for d1zdha_ (1zdh A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033773Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily)
    6-standed beta-sheet followed with 2 helices; meander
  4. 1033774Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) (S)
  5. 1033775Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins)
  6. 1033824Protein MS2 virus coat protein [55407] (1 species)
  7. 1033825Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries)
    Uniprot P03612
  8. 1033842Domain d1zdha_: 1zdh A: [40043]
    protein/RNA complex

Details for d1zdha_

PDB Entry: 1zdh (more details), 2.7 Å

PDB Description: ms2 coat protein/rna complex
PDB Compounds: (A:) protein (bacteriophage ms2 coat protein)

SCOPe Domain Sequences for d1zdha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zdha_ d.85.1.1 (A:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy

SCOPe Domain Coordinates for d1zdha_:

Click to download the PDB-style file with coordinates for d1zdha_.
(The format of our PDB-style files is described here.)

Timeline for d1zdha_: