Lineage for d1msc__ (1msc -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) 
Family d.85.1.1: RNA bacteriophage capsid protein [55406] (5 proteins) Protein MS2 virus coat protein [55407] (1 species) Species Bacteriophage MS2 [TaxId:12022] [55408] (25 PDB entries) 
Domain d1msc__: 1msc - [40039]
Details for d1msc__
PDB Entry: 1msc (more details), 2 Å
PDB Description: crystal structure of ms2 coat protein dimer
SCOP Domain Sequences for d1msc__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1msc__ d.85.1.1 (-) MS2 virus coat protein {Bacteriophage MS2}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaarrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
SCOP Domain Coordinates for d1msc__:
Click to download the PDB-style file with coordinates for d1msc__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1msc__:
- d1msc__ first appeared (with stable ids) in SCOP 1.55
- d1msc__ appears in SCOP 1.57
- d1msc__ appears in SCOP 1.61
- d1msc__ appears in the current release, SCOPe 2.08, called d1msca_
View in 3D