Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (1 family) |
Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein) |
Protein Subtilisin inhibitor [55401] (2 species) |
Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries) |
Domain d3sici_: 3sic I: [40028] Other proteins in same PDB: d3sice_ complexed with ca |
PDB Entry: 3sic (more details), 1.8 Å
SCOP Domain Sequences for d3sici_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans [TaxId: 1916]} yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg edvmcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf
Timeline for d3sici_: