SCOPe 2.08: Domain d3sici_: 3sic I:

Lineage for d3sici_ (3sic I:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families)

5. Family d.84.1.1: Subtilisin inhibitor [55400] (1 protein)
   automatically mapped to Pfam PF00720

6. Protein Subtilisin inhibitor [55401] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [55402] (3 PDB entries)

8. Domain d3sici_: 3sic I: [40028]
   Other proteins in same PDB: d3sice_
   complexed with ca

Details for d3sici_

PDB Entry: 3sic, 1.8 Å

PDB Description: molecular recognition at the active site of subtilisin bpn': crystallographic studies using genetically engineered proteinaceous inhibitor ssi (streptomyces subtilisin inhibitor)

PDB Compounds: (I:) streptomyces subtilisin inhibitor (ssi)

SCOPe Domain Sequences for d3sici_:

Sequence; same for both SEQRES and ATOM records:

>d3sici_ d.84.1.1 (I:) Subtilisin inhibitor {Streptomyces lividans [TaxId: 1916]}
yapsalvltvgkgvsattaaperavtltcapgpsgthpaagsacadlaavggdlnaltrg
edvmcpkvydpvlltvdgvwqgkrvsyervfsnecemnahgssvfaf

Timeline for d3sici_:

• d3sici_ first appeared (with stable ids) in SCOP 1.55
  
• d3sici_ appears in SCOPe 2.07