SCOPe 2.07: Domain d6qsuq2: 6qsu Q:106-238

Lineage for d6qsuq2 (6qsu Q:106-238)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.3: Urease, beta-subunit [51278] (2 families)
Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
Protein automated matches [192998] (2 species)
not a true protein
Species Helicobacter pylori [TaxId:210] [397956] (2 PDB entries)

Domain d6qsuq2: 6qsu Q:106-238 [400140]
Other proteins in same PDB: d6qsua1, d6qsuc1, d6qsue1, d6qsug1, d6qsui1, d6qsuk1, d6qsum1, d6qsuo1, d6qsuq1, d6qsus1, d6qsuu1, d6qsuw1
automated match to d1e9ya1
complexed with bme, ni

Details for d6qsuq2

PDB Entry: 6qsu (more details), 2.4 Å

PDB Description: helicobacter pylori urease with bme bound in the active site

PDB Compounds: (Q:) urease subunit alpha

SCOPe Domain Sequences for d6qsuq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qsuq2 b.85.3.1 (Q:106-238) automated matches {Helicobacter pylori [TaxId: 210]}
lvpgelflkneditinegkkavsvkvknvgdrpvqigshfhffevnrcldfdrektfgkr
ldiasgtavrfepgeeksvelidiggnrrifgfnalvdrqadneskkialhrakergfhg
tksddnyvktike

SCOPe Domain Coordinates for d6qsuq2:

Click to download the PDB-style file with coordinates for d6qsuq2.
(The format of our PDB-style files is described here.)

Timeline for d6qsuq2: