Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) |
Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein) |
Protein Copper amine oxidase, domain N [55385] (1 species) non-conserved N-terminal domain |
Species Escherichia coli [TaxId:562] [55386] (11 PDB entries) |
Domain d1d6zb4: 1d6z B:6-90 [40008] Other proteins in same PDB: d1d6za1, d1d6za2, d1d6za3, d1d6zb1, d1d6zb2, d1d6zb3 complexed with ca, cu, gol, hy1, pea, peo |
PDB Entry: 1d6z (more details), 2.1 Å
SCOPe Domain Sequences for d1d6zb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6zb4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]} hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd nkawvsdtfindvfqsgldqtfqve
Timeline for d1d6zb4:
View in 3D Domains from other chains: (mouse over for more information) d1d6za1, d1d6za2, d1d6za3, d1d6za4 |