Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
Protein automated matches [190603] (24 species) not a true protein |
Species Xanthomonas campestris [TaxId:339] [399774] (2 PDB entries) |
Domain d6m3sb1: 6m3s B:1-335 [400011] Other proteins in same PDB: d6m3sb2 automated match to d5grha_ complexed with gol, ica, nad |
PDB Entry: 6m3s (more details), 2.3 Å
SCOPe Domain Sequences for d6m3sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m3sb1 c.77.1.0 (B:1-335) automated matches {Xanthomonas campestris [TaxId: 339]} mtqtitvirgdgigpeimdatlfvldalqagltyeyadaglvalekhgdllpestlasit knkvalksplttpvgegfssinvamrrkfdlyanvrpaksfpntksrfadgvdlitvren tegaylsegqevsadgevavsgarvtrkgserivryafdlaratgrkkvtavhkaniiks tsglflkvardvatqypeiefqemivdntcmqlvmrpeqfdiivttnlfgdiisdlcagl vgglglapganigvdaaifeavhgsapdiagqgkanpcalllgaaqmldhigqpqnaerl reaivatleakdsltpdlggtgntmgfakaiasrl
Timeline for d6m3sb1: