Lineage for d6m3sb1 (6m3s B:1-335)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513202Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2513203Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2513666Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2513667Protein automated matches [190603] (24 species)
    not a true protein
  7. 2513844Species Xanthomonas campestris [TaxId:339] [399774] (2 PDB entries)
  8. 2513847Domain d6m3sb1: 6m3s B:1-335 [400011]
    Other proteins in same PDB: d6m3sb2
    automated match to d5grha_
    complexed with gol, ica, nad

Details for d6m3sb1

PDB Entry: 6m3s (more details), 2.3 Å

PDB Description: dimeric isocitrate dehydrogenase from xanthomonas campestris pv. campestris 8004
PDB Compounds: (B:) isocitrate dehydrogenase

SCOPe Domain Sequences for d6m3sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m3sb1 c.77.1.0 (B:1-335) automated matches {Xanthomonas campestris [TaxId: 339]}
mtqtitvirgdgigpeimdatlfvldalqagltyeyadaglvalekhgdllpestlasit
knkvalksplttpvgegfssinvamrrkfdlyanvrpaksfpntksrfadgvdlitvren
tegaylsegqevsadgevavsgarvtrkgserivryafdlaratgrkkvtavhkaniiks
tsglflkvardvatqypeiefqemivdntcmqlvmrpeqfdiivttnlfgdiisdlcagl
vgglglapganigvdaaifeavhgsapdiagqgkanpcalllgaaqmldhigqpqnaerl
reaivatleakdsltpdlggtgntmgfakaiasrl

SCOPe Domain Coordinates for d6m3sb1:

Click to download the PDB-style file with coordinates for d6m3sb1.
(The format of our PDB-style files is described here.)

Timeline for d6m3sb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6m3sb2
View in 3D
Domains from other chains:
(mouse over for more information)
d6m3sa_