Lineage for d1qkic2 (1qki C:200-434,C:450-511)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962135Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2962147Protein Glucose 6-phosphate dehydrogenase [55379] (2 species)
  7. 2962148Species Human (Homo sapiens) [TaxId:9606] [55381] (1 PDB entry)
  8. 2962151Domain d1qkic2: 1qki C:200-434,C:450-511 [39997]
    Other proteins in same PDB: d1qkia1, d1qkib1, d1qkic1, d1qkid1, d1qkie1, d1qkif1, d1qkig1, d1qkih1
    complexed with goa, gol, nap
    has additional insertions and/or extensions that are not grouped together

Details for d1qkic2

PDB Entry: 1qki (more details), 3 Å

PDB Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+
PDB Compounds: (C:) glucose-6-phosphate 1-dehydrogenase

SCOPe Domain Sequences for d1qkic2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qkic2 d.81.1.5 (C:200-434,C:450-511) Glucose 6-phosphate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
dhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdv
mqnhllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeat
kgylddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagd
ifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpXmhfv
rsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfqyegtykwvn

SCOPe Domain Coordinates for d1qkic2:

Click to download the PDB-style file with coordinates for d1qkic2.
(The format of our PDB-style files is described here.)

Timeline for d1qkic2: