PDB entry 1qki

View 1qki on RCSB PDB site
Description: x-ray structure of human glucose 6-phosphate dehydrogenase (variant canton r459l) complexed with structural nadp+
Class: oxidoreductase
Keywords: oxidoreductase, oxidoredutase, (choh(d)-nadp), glucose metabolism
Deposited on 1999-07-20, released 2000-03-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.247
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkia1, d1qkia2
  • Chain 'B':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkib1, d1qkib2
  • Chain 'C':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkic1, d1qkic2
  • Chain 'D':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkid1, d1qkid2
  • Chain 'E':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkie1, d1qkie2
  • Chain 'F':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkif1, d1qkif2
  • Chain 'G':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkig1, d1qkig2
  • Chain 'H':
    Compound: glucose-6-phosphate 1-dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: G6PD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11413
      • variant (457)
    Domains in SCOPe 2.06: d1qkih1, d1qkih2
  • Heterogens: NAP, GOA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qkiA (A:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiA (A:)
    vcghqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirkq
    sepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylalp
    ptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhyl
    gkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqnh
    llqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgyl
    ddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifhq
    qckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlild
    vfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfqy
    egtykwvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qkiB (B:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiB (B:)
    hvcgiqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
    qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
    pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhy
    lgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqn
    hllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgy
    lddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifh
    qqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlil
    dvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfq
    yegtykwvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qkiC (C:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiC (C:)
    hvcgiqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
    qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
    pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhy
    lgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqn
    hllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgy
    lddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifh
    qqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlil
    dvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfq
    yegtykwvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qkiD (D:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiD (D:)
    thvcgiqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadir
    kqsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfyla
    lpptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridh
    ylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmq
    nhllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkg
    ylddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdif
    hqqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerli
    ldvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgf
    qyegtykwvn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qkiE (E:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiE (E:)
    thvcsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirkqs
    epffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylalpp
    tvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhylg
    kemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqnhl
    lqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgyld
    dptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifhqq
    ckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlildv
    fcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfqye
    gtykwvn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qkiF (F:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiF (F:)
    srthvcgqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadi
    rkqsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfyl
    alpptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyrid
    hylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvm
    qnhllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatk
    gylddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdi
    fhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerl
    ildvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvg
    fqyegtykwvn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1qkiG (G:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiG (G:)
    thvcgqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
    qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
    pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhy
    lgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqn
    hllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgy
    lddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifh
    qqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlil
    dvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfq
    yegtykwvn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qkiH (H:)
    aeqvalsrthvcgilreelfqgdafhqsdthifiimgasgdlakkkiyptiwwlfrdgll
    pentfivgyarsrltvadirkqsepffkatpeeklkledffarnsyvagqyddaasyqrl
    nshmnalhlgsqanrlfylalpptvyeavtknihescmsqigwnriivekpfgrdlqssd
    rlsnhisslfredqiyridhylgkemvqnlmvlrfanrifgpiwnrdniacviltfkepf
    gtegrggyfdefgiirdvmqnhllqmlclvamekpastnsddvrdekvkvlkcisevqan
    nvvlgqyvgnpdgegeatkgylddptvprgsttatfaavvlyvenerwdgvpfilrcgka
    lnerkaevrlqfhdvagdifhqqckrnelvirvqpneavytkmmtkkpgmffnpeeseld
    ltygnryknvklpdayerlildvfcgsqmhfvrsdelleawriftpllhqielekpkpip
    yiygsrgpteadelmkrvgfqyegtykwvnphkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qkiH (H:)
    thvcgqsdthifiimgasgdlakkkiyptiwwlfrdgllpentfivgyarsrltvadirk
    qsepffkatpeeklkledffarnsyvagqyddaasyqrlnshmnalhlgsqanrlfylal
    pptvyeavtknihescmsqigwnriivekpfgrdlqssdrlsnhisslfredqiyridhy
    lgkemvqnlmvlrfanrifgpiwnrdniacviltfkepfgtegrggyfdefgiirdvmqn
    hllqmlclvamekpastnsddvrdekvkvlkcisevqannvvlgqyvgnpdgegeatkgy
    lddptvprgsttatfaavvlyvenerwdgvpfilrcgkalnerkaevrlqfhdvagdifh
    qqckrnelvirvqpneavytkmmtkkpgmffnpeeseldltygnryknvklpdayerlil
    dvfcgsqmhfvrsdelleawriftpllhqielekpkpipyiygsrgpteadelmkrvgfq
    yegtykwvn