SCOPe 2.07: Domain d6lwta2: 6lwt A:129-227

Lineage for d6lwta2 (6lwt A:129-227)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:46170] [399789] (1 PDB entry)

8. Domain d6lwta2: 6lwt A:129-227 [399790]
   Other proteins in same PDB: d6lwta1, d6lwta3, d6lwtb1, d6lwtb3
   automated match to d3r2ta2

Details for d6lwta2

PDB Entry: 6lwt, 1.9 Å

PDB Description: crystal structure of staphylococcal superantigen-like protein 10

PDB Compounds: (A:) Superantigen-like protein SSL10

SCOPe Domain Sequences for d6lwta2:

Sequence; same for both SEQRES and ATOM records:

>d6lwta2 d.15.6.0 (A:129-227) automated matches {Staphylococcus aureus [TaxId: 46170]}
vsapilniskekgedafvkgypyyikkekitlkeldyklrkhliekyglyktiskdgrvk
islkdgsfynldlrsklkfkymgevieskqikdievnlk

Timeline for d6lwta2:

• d6lwta2 is new in SCOPe 2.07-stable
  
• d6lwta2 appears in the current release, SCOPe 2.08