Lineage for d1ofga2 (1ofg A:161-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2961609Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2961610Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2962135Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins)
    has many additional secondary structures
  6. 2962168Protein Glucose-fructose oxidoreductase [55377] (1 species)
    very similar to the glucose 6-phosphate dehydrogenase domain
  7. 2962169Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries)
  8. 2962194Domain d1ofga2: 1ofg A:161-322 [39979]
    Other proteins in same PDB: d1ofga1, d1ofgb1, d1ofgc1, d1ofgd1, d1ofge1, d1ofgf1
    complexed with ndp

Details for d1ofga2

PDB Entry: 1ofg (more details), 2.7 Å

PDB Description: glucose-fructose oxidoreductase
PDB Compounds: (A:) glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1ofga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofga2 d.81.1.5 (A:161-322) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]}
dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln
gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs
vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan

SCOPe Domain Coordinates for d1ofga2:

Click to download the PDB-style file with coordinates for d1ofga2.
(The format of our PDB-style files is described here.)

Timeline for d1ofga2: