| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) |
| Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries) |
| Domain d1ofgd1: 1ofg D:1-160,D:323-381 [30067] Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2 complexed with ndp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ofg (more details), 2.7 Å
SCOPe Domain Sequences for d1ofgd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofgd1 c.2.1.3 (D:1-160,D:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
Timeline for d1ofgd1: